When analyzing the amino acid sequences of the globin proteins shown in this fig
ID: 1031974 • Letter: W
Question
When analyzing the amino acid sequences of the globin proteins shown in this figure, which of the following statements are true? A helix B helix C helix Human B globin VHUTPEEKSAVTALWGKVN-VDEVGGEALGRLLVVY PWTORFFESFGDL E7 FB D helix E helix F helix Human a globin Human globin Human myoglobin AQVKGHORKVADALYNAVAHVODMPNALSALSDLHAHKLRV S-DAVMghPKVKAHOKKVLGAFSDGL AHLDNIKOTÍ, A T L S E LHcpKUW SEDEMKASEDLKKHGATVLTALGGILKKKGHHEALUKP LAOSHATKHKI G helix H helix Human globin Human myoglobin pPENER LGNVLVCYLAHyF G K E Ft PPVQAAYOKVVAGVANALAHKY PVKYLEFISECIIOVLOSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGExplanation / Answer
A and C are the correct ones because if we change any amino acid with another, it will ultimately affect the functioning of the protein in some way because it will alter the protein composition and thus its function.