Academic Integrity: tutoring, explanations, and feedback — we don’t complete graded work or submit on a student’s behalf.

7. The graph shows a hypothetical pathway similar to glycolysis, in which the ca

ID: 151954 • Letter: 7

Question

7. The graph shows a hypothetical pathway similar to glycolysis, in which the catabolic intermediates are designated A, B, C, etc. The energetic contributions of activated carrier molecules have been omitted from this energy plot. Which reaction is most likely to occur without an enzyme? Which reaction is most likely to be catalyzed by an enzyme that simultaneously uses ATP as a substrate? Which reaction is most likely to be catalyzed by an enzyme that simultaneously uses ADP as a substrate and produces ATP? Which reaction can most readily be driven by a subsequent reaction that acts as a siphon on the product? For each of the four answers, explain your reasoning 35 30 25 20 10 sequence of metabolites and reactions 8. Below are the partial protein sequences for the same transmembrane protein in the mouse and zebrafish. The amino acid sequence is written as single amino acid letters and is aligned based on similarity. The dash (-) represents a gap in the alignment. Which of the four lines likely contains the transmembrane domain of this protein? Explain why. Bolded regions have significant similarity. Explain what these regions are conserved. What might be their function? NTANITVKYGQFNREHAKFHYLPVLISDNGVPSLTGTSTLTVGVCKCNEQGEFTFCEEMA zebratisbNTATIVLKOGGFSTENSEEYVLEIEIADGGTPEQKSVNLLOIKVCTCOSGRRVEYCMSYA naise AQAGVSIQALVAIFLCILTITVITLLIILRRRIRKQAHAHSKSALEIHEQLVTYDEEGGG zebratisbR-TGMSVSALLAILLCIITILVIVILIVLRRRYQKEVLVT-KASGEIHEQLVRYDEEGGG EMDTTSYDVSVLNSVRGGSTKPLRSTMDARPAVYTOVOKPPRLAPGLHGGPREMATMIDV zebrafish EMDTNGYDVSILSSACHDSS-FRPSVG--PALYAMVKKPP-ACKG-DMAMMIEV KKEEADNDGGGPPYDTLHIYGYEGAESIAESLSSLSTNSSDSDIDYDELNDWGPREKMLA zebrafisbKKDEADRDRDGIPYDTLHIYGYEGTESLAGSLSSLDSSSSGSNLDYDFIHENGPRERTLA

Explanation / Answer

Answer 7-

i. Which reaction is most likely to occur without an enzyme-

F to G ( normally enzyme decreases the activation energy.. We can see in the graph that this reaction have lowest activation energy ).

ii. Which reaction is most likely to be catalyzed by an enzyme that simultaneously uses ATP as substrate-

A to B ( here we can see, only A is the substrate in all substrates which is giving high energy product so it will use ATP as substrate.

iii. Which reaction is most likely to be catalyzed by an enzyme that simultaneously uses ADP as substrate and produces ATP-

D to E ( here we can see, this is the only reaction which is releasing maximum energy, and energy is released in the form of ATP only)

iv. Which reaction can most readily be driven by a subsequent reaction that act as a siphon on the product-

E to F ( here we can see, E is having more energy as compare to G, this reaction occurs with an increase in energy and it is siphoning by F to G forwardly)

Thanking You