Name Post-lab Questions: 1. What is Bioinformatics? Bioinformatics tools allow u
ID: 302924 • Letter: N
Question
Name Post-lab Questions: 1. What is Bioinformatics? Bioinformatics tools allow us to use protein and nucleic acid information. 2. for the retrieval of omic data, which includes DNA, RNA, and protein sequences are stored in a number of databases housed by Multiple sequence alignment of DNA or protein sequences allows us to determine evolutionary relationship. True 4. or False. Pecent Identity can be used to indicate degree of relatedness between multiple sequences. True or False 5. ATPADWRSQSIYFLLTDRFARTDGSTTATCNTADQKYCGGTWOGIIDKLDY IQGMGFTAIWITPVTAQLPOTTAYGDA The above stretch of letters shows the sequence of letter code for each 6· using a one 7. Use the 3 letter code (page 169) to rewrite QGMGFTAIWI amino acid sequence 8. Match the following: Set B A. aspartate (D182)glutamate (E248) Set A 1. NCBI accession number 2. PDB ID 3. amino acids in the active site /aspartate (D312) B. tertiary structure C. secondary structures that are stabilized of human amylase by hydrogen bonds D. primary structure E. conserved amino acids 4. alpha helices and beta pleated sheets are examples of an entire polypeptide chain including F. can be determined by multiple sequence alpha helices, beta sheets and other loops, turns and bends 5. total 3D conformation (shape) of alignment using Clustal Omega G. retrive amino acid sequence of the three amylases used in the lab 6. the sequence of amino acids in a H. view 3D structure of protein on computer ploypeptide chain detemines the way a protein folds into a unique 3D shape (native conformation) 7. % identity 8.90 homologyExplanation / Answer
1.) Bioinformatics is the interdisciplinary field of science which involves application of biology, mathematics and computer science that develops methods and tools for biological data.
2.) Homology
3.)genome browser
4.)false