Course Contents »... »Homework 3 4 (4 pts) The peptide TSQEDRVILPDNKHNHYEDENDKSG

Question

Course Contents »... »Homework 3 4 (4 pts) The peptide TSQEDRVILPDNKHNHYEDENDKSGHPLWCAAL will yield: O 4 fragments with trypsin, 3 with chymotrypsin, none with cyanogen bromide. O 4 fragments with chymotrypsin, 3 with trypsin, 2 with cyanogen bromide O 2 fragments with trypsin, 3 with chymotrypsin, none with cyanogen bromide. O No fragments with trypsin, 2 with chymotrypsin, three with cyanogen bromide. O 3 fragments with cyanogen bromide, 4 with trypsin, none with chymotrypsin Submit Answer Tries 0/99 Post Discussion

Explanation / Answer

the correct answer would be the first one i.e 4 with trypsin and 3 with chymotrypsin

Chymotrypsin is site specific and will only cleave the carboxyl side of large hydrophobic or aromatic amino acids such as phenylalanine (Phe), methionine (Met), tyrosine (Tyr), and tryptophan (Trp), unless the next amino acid is proline (Pro).

Trypsin cleaves peptide chains mainly at the carboxyl side of the amino acids lysine or arginine, except when either is followed by proline.

Related Questions

Navigate

• Browse (All)
• Browse C
• Subjects

---